File size: 32,294 Bytes
bb74251 712d350 bd0d9fa bb74251 0c337fe 5a9ba24 bb74251 bd0d9fa bb74251 bd0d9fa bb74251 712d350 7ebbadf 5a9ba24 7ebbadf 5a9ba24 7ebbadf 5a9ba24 7ebbadf 712d350 7ebbadf 712d350 7ebbadf 5a9ba24 7ebbadf 712d350 bd0d9fa 7ebbadf bd0d9fa 5a9ba24 bd0d9fa 5a9ba24 bd0d9fa 5a9ba24 bd0d9fa 5a9ba24 bd0d9fa 5a9ba24 bd0d9fa 5a9ba24 bd0d9fa 5a9ba24 bd0d9fa 5a9ba24 712d350 bb74251 0c337fe 5a9ba24 0c337fe bb74251 bd0d9fa bb74251 bd0d9fa bb74251 bd0d9fa 5a9ba24 bd0d9fa bb74251 bd0d9fa bb74251 bd0d9fa 5a9ba24 bd0d9fa 5a9ba24 bd0d9fa 5a9ba24 bd0d9fa bb74251 bd0d9fa bb74251 bd0d9fa bb74251 bd0d9fa bb74251 bd0d9fa bb74251 bd0d9fa bb74251 bd0d9fa bb74251 bd0d9fa bb74251 bd0d9fa bb74251 bd0d9fa bb74251 bd0d9fa bb74251 bd0d9fa bb74251 bd0d9fa bb74251 |
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740 741 742 743 744 745 746 747 748 749 750 751 752 753 754 755 |
{
"cells": [
{
"cell_type": "markdown",
"id": "458aed0f",
"metadata": {},
"source": [
"<small>Note: This notebook is adapted from the [AbLang2](https://github.com/TobiasHeOl/AbLang2) model's GitHub repository. It is used to verify that the Hugging Face implementation functions correctly and produces the same output as the original model."
]
},
{
"cell_type": "code",
"execution_count": 1,
"id": "a51e7ed2",
"metadata": {},
"outputs": [],
"source": [
"!rm -rf ~/.cache/huggingface/hub/models--hemantn--ablang2"
]
},
{
"cell_type": "code",
"execution_count": 2,
"id": "7ae54cd0-6253-46dd-a316-4f20b12041e0",
"metadata": {},
"outputs": [],
"source": [
"import sys\n",
"import os\n",
"import numpy as np\n",
"from transformers import AutoModel, AutoTokenizer\n",
"from huggingface_hub import hf_hub_download"
]
},
{
"cell_type": "markdown",
"id": "10801511-770d-46ac-a15d-a02d4ef9ec87",
"metadata": {},
"source": [
"# **0. Sequence input and its format**\n",
"\n",
"AbLang2 takes as input either the individual heavy variable domain (VH), light variable domain (VL), or the full variable domain (Fv).\n",
"\n",
"Each record (antibody) needs to be a list with the VH as the first element and the VL as the second. If either the VH or VL is not known, leave an empty string.\n",
"\n",
"An asterisk (\\*) is used for masking. It is recommended to mask residues which you are interested in mutating.\n",
"\n",
"**NB:** It is important that the VH and VL sequence is ordered correctly."
]
},
{
"cell_type": "code",
"execution_count": 3,
"id": "99192978-a008-4a32-a80e-bba238e0ec7c",
"metadata": {},
"outputs": [],
"source": [
"seq1 = [\n",
" 'EVQLLESGGEVKKPGASVKVSCRASGYTFRNYGLTWVRQAPGQGLEWMGWISAYNGNTNYAQKFQGRVTLTTDTSTSTAYMELRSLRSDDTAVYFCARDVPGHGAAFMDVWGTGTTVTVSS', # VH sequence\n",
" 'DIQLTQSPLSLPVTLGQPASISCRSSQSLEASDTNIYLSWFQQRPGQSPRRLIYKISNRDSGVPDRFSGSGSGTHFTLRISRVEADDVAVYYCMQGTHWPPAFGQGTKVDIK' # VL sequence\n",
"]\n",
"seq2 = [\n",
" 'EVQLLESGGEVKKPGASVKVSCRASGYTFRNYGLTWVRQAPGQGLEWMGWISAYNGNTNYAQKFQGRVTLTTDTSTSTAYMELRSLRSDDTAVYFCARDVPGHGAAFMDVWGTGTT',\n",
" 'PVTLGQPASISCRSSQSLEASDTNIYLSWFQQRPGQSPRRLIYKISNRDSGVPDRFSGSGSGTHFTLRISRVEADDVAVYYCMQGTHWPPAFGQGTKVDIK'\n",
"]\n",
"seq3 = [\n",
" 'EVQLLESGGEVKKPGASVKVSCRASGYTFRNYGLTWVRQAPGQGLEWMGWISAYNGNTNYAQKFQGRVTLTTDTSTSTAYMELRSLRSDDTAVYFCARDVPGHGAAFMDVWGTGTTVTVSS',\n",
" '' # The VL sequence is not known, so an empty string is left instead. \n",
"]\n",
"seq4 = [\n",
" '',\n",
" 'DIQLTQSPLSLPVTLGQPASISCRSSQSLEASDTNIYLSWFQQRPGQSPRRLIYKISNRDSGVPDRFSGSGSGTHFTLRISRVEADDVAVYYCMQGTHWPPAFGQGTKVDIK'\n",
"]\n",
"seq5 = [\n",
" 'EVQ***SGGEVKKPGASVKVSCRASGYTFRNYGLTWVRQAPGQGLEWMGWISAYNGNTNYAQKFQGRVTLTTDTSTSTAYMELRSLRSDDTAVYFCAR**PGHGAAFMDVWGTGTTVTVSS', # (*) is used to mask certain residues\n",
" 'DIQLTQSPLSLPVTLGQPASISCRSS*SLEASDTNIYLSWFQQRPGQSPRRLIYKI*NRDSGVPDRFSGSGSGTHFTLRISRVEADDVAVYYCMQGTHWPPAFGQGTKVDIK'\n",
"]\n",
"\n",
"all_seqs = [seq1, seq2, seq3, seq4, seq5]\n",
"only_both_chains_seqs = [seq1, seq2, seq5]"
]
},
{
"cell_type": "markdown",
"id": "dffbacfa-8642-4d94-9572-2205a05c18f9",
"metadata": {},
"source": [
"# **1. How to use AbLang2**\n",
"\n",
"AbLang2 can be downloaded and used in its raw form as seen below. For convenience, we have also developed different \"modes\" which can be used for specific use cases (see Section 2) "
]
},
{
"cell_type": "code",
"execution_count": 4,
"id": "6d66ad84",
"metadata": {},
"outputs": [
{
"data": {
"application/vnd.jupyter.widget-view+json": {
"model_id": "ed2d5574bd21463c9244070ab762c31e",
"version_major": 2,
"version_minor": 0
},
"text/plain": [
"config.json: 0%| | 0.00/763 [00:00<?, ?B/s]"
]
},
"metadata": {},
"output_type": "display_data"
},
{
"data": {
"application/vnd.jupyter.widget-view+json": {
"model_id": "10e1a02037f74d2da6e0860ef914829b",
"version_major": 2,
"version_minor": 0
},
"text/plain": [
"configuration_ablang2paired.py: 0.00B [00:00, ?B/s]"
]
},
"metadata": {},
"output_type": "display_data"
},
{
"name": "stderr",
"output_type": "stream",
"text": [
"A new version of the following files was downloaded from https://huggingface.co/hemantn/ablang2:\n",
"- configuration_ablang2paired.py\n",
". Make sure to double-check they do not contain any added malicious code. To avoid downloading new versions of the code file, you can pin a revision.\n"
]
},
{
"data": {
"application/vnd.jupyter.widget-view+json": {
"model_id": "eaf036440107433f950cf4b8c652d756",
"version_major": 2,
"version_minor": 0
},
"text/plain": [
"modeling_ablang2paired.py: 0.00B [00:00, ?B/s]"
]
},
"metadata": {},
"output_type": "display_data"
},
{
"name": "stderr",
"output_type": "stream",
"text": [
"A new version of the following files was downloaded from https://huggingface.co/hemantn/ablang2:\n",
"- modeling_ablang2paired.py\n",
". Make sure to double-check they do not contain any added malicious code. To avoid downloading new versions of the code file, you can pin a revision.\n",
"/home/hn533621/.conda/envs/lib_transformer/lib/python3.10/site-packages/huggingface_hub/file_download.py:943: FutureWarning: `resume_download` is deprecated and will be removed in version 1.0.0. Downloads always resume when possible. If you want to force a new download, use `force_download=True`.\n",
" warnings.warn(\n"
]
},
{
"data": {
"application/vnd.jupyter.widget-view+json": {
"model_id": "22b9a58a3100420c9e353415e7194af6",
"version_major": 2,
"version_minor": 0
},
"text/plain": [
"model.pt: 0%| | 0.00/179M [00:00<?, ?B/s]"
]
},
"metadata": {},
"output_type": "display_data"
},
{
"name": "stdout",
"output_type": "stream",
"text": [
"✅ Loaded custom weights from: /home/hn533621/.cache/huggingface/hub/models--hemantn--ablang2/snapshots/13d4401549c368256c517dc13b8ed3d8b28d5e87/model.pt\n"
]
},
{
"data": {
"application/vnd.jupyter.widget-view+json": {
"model_id": "e1c40183f9104aa1a67bf9b1c3daea0c",
"version_major": 2,
"version_minor": 0
},
"text/plain": [
"tokenizer_ablang2paired.py: 0.00B [00:00, ?B/s]"
]
},
"metadata": {},
"output_type": "display_data"
},
{
"name": "stderr",
"output_type": "stream",
"text": [
"A new version of the following files was downloaded from https://huggingface.co/hemantn/ablang2:\n",
"- tokenizer_ablang2paired.py\n",
". Make sure to double-check they do not contain any added malicious code. To avoid downloading new versions of the code file, you can pin a revision.\n"
]
},
{
"data": {
"application/vnd.jupyter.widget-view+json": {
"model_id": "3fadab1179e2438ba88e08efb7819680",
"version_major": 2,
"version_minor": 0
},
"text/plain": [
"vocab.json: 0%| | 0.00/331 [00:00<?, ?B/s]"
]
},
"metadata": {},
"output_type": "display_data"
},
{
"data": {
"application/vnd.jupyter.widget-view+json": {
"model_id": "5673cfaa95ac4da78e627c36ad6191b0",
"version_major": 2,
"version_minor": 0
},
"text/plain": [
"adapter.py: 0.00B [00:00, ?B/s]"
]
},
"metadata": {},
"output_type": "display_data"
},
{
"name": "stdout",
"output_type": "stream",
"text": [
"📁 Files in current directory (/home/hn533621/.cache/huggingface/hub/models--hemantn--ablang2/snapshots/13d4401549c368256c517dc13b8ed3d8b28d5e87):\n",
" adapter.py\n",
" configuration_ablang2paired.py\n",
" tokenizer_ablang2paired.py\n",
" modeling_ablang2paired.py\n",
"✅ Successfully imported utility modules from cache directory\n"
]
}
],
"source": [
"# Load model and tokenizer from Hugging Face Hub\n",
"model = AutoModel.from_pretrained(\"hemantn/ablang2\", trust_remote_code=True)\n",
"tokenizer = AutoTokenizer.from_pretrained(\"hemantn/ablang2\", trust_remote_code=True)\n",
"\n",
"# Find the cached model directory and import adapter\n",
"adapter_path = hf_hub_download(repo_id=\"hemantn/ablang2\", filename=\"adapter.py\")\n",
"cached_model_dir = os.path.dirname(adapter_path)\n",
"sys.path.insert(0, cached_model_dir)\n",
"\n",
"# Import and create the adapter\n",
"from adapter import AbLang2PairedHuggingFaceAdapter\n",
"ablang = AbLang2PairedHuggingFaceAdapter(model=model, tokenizer=tokenizer)"
]
},
{
"cell_type": "markdown",
"id": "48562761-6ebe-4025-be97-918c9f9eff7e",
"metadata": {},
"source": [
"# **2. Different modes for specific usecases**\n",
"\n",
"AbLang2 has already been implemented for a variety of different usecases. The benefit of these modes is that they handle extra tokens such as start, stop and separation tokens.\n",
"\n",
"1. seqcoding: Generates sequence representations for each sequence\n",
"2. rescoding: Generates residue representations for each residue in each sequence\n",
"3. likelihood: Generates likelihoods for each amino acid at each position in each sequence\n",
"4. probability: Generates probabilities for each amino acid at each position in each sequence\n",
"5. pseudo_log_likelihood: Returns the pseudo log likelihood for a sequence (based on masking each residue one at a time)\n",
"6. confidence: Returns a fast calculation of the log likelihood for a sequence (based on a single pass with no masking)\n",
"7. restore: Restores masked residues\n",
"\n",
"### **AbLang2 can also align the resulting representations using ANARCI**\n",
"\n",
"This can be done for 'rescoding', 'likelihood', and 'probability'. This is done by setting the argument \"align=True\".\n",
"\n",
"**NB**: Align can only be used on input with the same format, i.e. either all heavy, all light, or all both heavy and light.\n",
"\n",
"### **The align argument can also be used to restore variable missing lengths**\n",
"\n",
"For this, use \"align=True\" with the 'restore' mode."
]
},
{
"cell_type": "code",
"execution_count": 5,
"id": "ceae4a88-0679-4704-8bad-c06a4569c497",
"metadata": {},
"outputs": [],
"source": [
"valid_modes = [\n",
" 'seqcoding', 'rescoding', 'likelihood', 'probability',\n",
" 'pseudo_log_likelihood', 'confidence', 'restore' \n",
"]"
]
},
{
"cell_type": "markdown",
"id": "aa333732-7508-4826-92ec-3acdd54bc1bb",
"metadata": {},
"source": [
"## **seqcoding** \n",
"\n",
"The seqcodings represents each sequence as a 480 sized embedding. It is derived from averaging across each rescoding embedding for a given sequence, including extra tokens. \n",
"\n",
"**NB:** Seqcodings can also be derived in other ways like using the sum or averaging across only parts of the input such as the CDRs. For such cases please use and adapt the below rescoding."
]
},
{
"cell_type": "code",
"execution_count": 6,
"id": "d22f4302-1262-4cc1-8a1c-a36daa8c710c",
"metadata": {},
"outputs": [
{
"data": {
"text/plain": [
"array([[-0.2520631 , 0.18189636, 0.00887137, ..., 0.15365516,\n",
" -0.14508602, -0.13381316],\n",
" [-0.24383117, 0.20946886, 0.07412891, ..., 0.15079288,\n",
" -0.13847049, -0.07304662],\n",
" [-0.20084268, 0.23405147, -0.00103735, ..., 0.07450922,\n",
" -0.08084311, -0.21812904],\n",
" [-0.12659703, 0.3051279 , -0.15117611, ..., -0.20749238,\n",
" -0.10453435, -0.0787883 ],\n",
" [-0.2955319 , 0.17239201, 0.05676926, ..., 0.15943624,\n",
" -0.16615382, -0.15569784]], shape=(5, 480), dtype=float32)"
]
},
"execution_count": 6,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
"ablang(all_seqs, mode='seqcoding')\n"
]
},
{
"cell_type": "markdown",
"id": "4b5d9d60",
"metadata": {},
"source": [
"## **rescoding / likelihood / probability**\n",
"\n",
"The rescodings represents each residue as a 480 sized embedding. The likelihoods represents each residue as the predicted logits for each character in the vocabulary. The probabilities represents the normalised likelihoods.\n",
"\n",
"**NB:** The output includes extra tokens (start, stop and separation tokens) in the format \"<VH_seq>|<VL_seq>\". The length of the output is therefore 5 longer than the VH and VL.\n",
"\n",
"**NB:** By default the representations are derived using a single forward pass. To prevent the predicted likelihood and probability to be affected by the input residue at each position, setting the \"stepwise_masking\" argument to True can be used. This will run a forward pass for each position with the residue at that position masked. This is much slower than running a single forward pass."
]
},
{
"cell_type": "code",
"execution_count": 7,
"id": "6227f661-575f-4b1e-9646-cfba7b10c3b4",
"metadata": {},
"outputs": [
{
"data": {
"text/plain": [
"[array([[-0.40741208, -0.5118987 , 0.06096708, ..., 0.3268144 ,\n",
" 0.03920235, -0.36715826],\n",
" [-0.5768883 , 0.38245413, -0.21791998, ..., 0.01250262,\n",
" -0.08844463, -0.32367525],\n",
" [-0.1475935 , 0.39639047, -0.38226923, ..., -0.10119921,\n",
" -0.41469565, -0.00319315],\n",
" ...,\n",
" [-0.14358369, 0.3124389 , -0.30157998, ..., -0.13289244,\n",
" -0.45353398, -0.07878865],\n",
" [ 0.17538925, 0.24394299, 0.20141171, ..., 0.14587352,\n",
" -0.38479003, 0.07409196],\n",
" [-0.23031706, -0.35487285, 0.1960684 , ..., -0.1283362 ,\n",
" 0.31107333, -0.3265108 ]], shape=(238, 480), dtype=float32),\n",
" array([[-0.41981837, -0.3666375 , 0.10595217, ..., 0.3903574 ,\n",
" 0.0382378 , -0.36337993],\n",
" [-0.5054137 , 0.38347068, -0.10992069, ..., -0.05231472,\n",
" -0.13636623, -0.34830108],\n",
" [-0.06784609, 0.69349885, -0.4212398 , ..., -0.24805346,\n",
" -0.39583805, -0.10972726],\n",
" ...,\n",
" [-0.02212614, 0.26338235, -0.5558968 , ..., -0.24067189,\n",
" -0.11965694, 0.07879876],\n",
" [-0.20650092, 0.43451664, -0.09650223, ..., -0.05296766,\n",
" -0.04297376, 0.41854134],\n",
" [-0.02653179, 0.03729444, 0.13194172, ..., -0.4554279 ,\n",
" 0.03723941, 0.17769177]], shape=(238, 480), dtype=float32),\n",
" array([[-0.40043733, -0.48596814, 0.0886725 , ..., 0.38941646,\n",
" 0.06195956, -0.40999672],\n",
" [-0.54576075, 0.4312959 , -0.3451486 , ..., -0.09285564,\n",
" 0.03116508, -0.45269737],\n",
" [ 0.0221165 , 0.53196615, -0.30137214, ..., -0.1889072 ,\n",
" -0.32587305, 0.05078396],\n",
" ...,\n",
" [-0.03700298, 0.7739084 , 0.3454928 , ..., -0.03060072,\n",
" 0.02420983, -0.48005292],\n",
" [-0.03366657, 0.74771184, -0.35423476, ..., -0.08759108,\n",
" -0.17898935, -0.4540483 ],\n",
" [-0.16625853, 0.2701079 , -0.19761363, ..., 0.10313392,\n",
" 0.44890267, -0.64840287]], shape=(238, 480), dtype=float32),\n",
" array([[-0.26863217, 0.32259187, 0.10813517, ..., 0.03953876,\n",
" 0.18312076, -0.00498045],\n",
" [-0.2165424 , -0.38562432, -0.02696264, ..., 0.20541488,\n",
" 0.18698391, -0.22639504],\n",
" [-0.41950518, 0.04743317, 0.0048816 , ..., 0.11408642,\n",
" -0.05384652, 0.1025871 ],\n",
" ...,\n",
" [-0.14095458, 0.5860325 , -0.44657114, ..., -0.39150292,\n",
" -0.22395667, -0.42516366],\n",
" [ 0.29816052, 0.40440455, -0.52062094, ..., 0.08969188,\n",
" -0.20792632, -0.2045222 ],\n",
" [-0.21370608, 0.23035707, -0.355185 , ..., -0.36726946,\n",
" -0.05693531, -0.37847823]], shape=(238, 480), dtype=float32),\n",
" array([[-0.42062947, -0.44009134, 0.00152371, ..., 0.27141467,\n",
" 0.03798106, -0.397461 ],\n",
" [-0.57318133, 0.5258899 , -0.17001636, ..., -0.23864633,\n",
" 0.2088059 , -0.57877594],\n",
" [-0.38988614, 0.46168196, -0.3429413 , ..., -0.14872643,\n",
" -0.46576905, -0.21224979],\n",
" ...,\n",
" [-0.21528634, 0.30046722, -0.25216463, ..., -0.11576828,\n",
" -0.4704907 , -0.0740136 ],\n",
" [ 0.0633081 , 0.22700705, 0.28184187, ..., 0.15967266,\n",
" -0.377182 , 0.06188517],\n",
" [-0.27826303, -0.37297496, 0.21229912, ..., -0.14886017,\n",
" 0.24998347, -0.35954213]], shape=(238, 480), dtype=float32)]"
]
},
"execution_count": 7,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
"ablang(all_seqs, mode='rescoding', stepwise_masking = False)"
]
},
{
"cell_type": "markdown",
"id": "6da2183b-4306-49bd-a7fc-23e78a23f305",
"metadata": {},
"source": [
"## **Align rescoding/likelihood/probability output**\n",
"\n",
"For the 'rescoding', 'likelihood', and 'probability' modes, the output can also be aligned using the argument \"align=True\".\n",
"\n",
"This is done using the antibody numbering tool ANARCI, and requires manually installing **Pandas** and **[ANARCI](https://github.com/oxpig/ANARCI)**.\n",
"\n",
"**NB**: Align can only be used on input with the same format, i.e. either all heavy, all light, or all both heavy and light."
]
},
{
"cell_type": "code",
"execution_count": 8,
"id": "e4bc0cb1-f5b0-4255-9e93-d643ae1396df",
"metadata": {},
"outputs": [
{
"name": "stdout",
"output_type": "stream",
"text": [
"['<' '1 ' '2 ' '3 ' '4 ' '5 ' '6 ' '7 ' '8 ' '9 ' '11 ' '12 ' '13 ' '14 '\n",
" '15 ' '16 ' '17 ' '18 ' '19 ' '20 ' '21 ' '22 ' '23 ' '24 ' '25 ' '26 '\n",
" '27 ' '28 ' '29 ' '30 ' '35 ' '36 ' '37 ' '38 ' '39 ' '40 ' '41 ' '42 '\n",
" '43 ' '44 ' '45 ' '46 ' '47 ' '48 ' '49 ' '50 ' '51 ' '52 ' '53 ' '54 '\n",
" '55 ' '56 ' '57 ' '58 ' '59 ' '62 ' '63 ' '64 ' '65 ' '66 ' '67 ' '68 '\n",
" '69 ' '70 ' '71 ' '72 ' '74 ' '75 ' '76 ' '77 ' '78 ' '79 ' '80 ' '81 '\n",
" '82 ' '83 ' '84 ' '85 ' '86 ' '87 ' '88 ' '89 ' '90 ' '91 ' '92 ' '93 '\n",
" '94 ' '95 ' '96 ' '97 ' '98 ' '99 ' '100 ' '101 ' '102 ' '103 ' '104 '\n",
" '105 ' '106 ' '107 ' '108 ' '109 ' '110 ' '111 ' '112A' '112 ' '113 '\n",
" '114 ' '115 ' '116 ' '117 ' '118 ' '119 ' '120 ' '121 ' '122 ' '123 '\n",
" '124 ' '125 ' '126 ' '127 ' '128 ' '>' '|' '<' '1 ' '2 ' '3 ' '4 ' '5 '\n",
" '6 ' '7 ' '8 ' '9 ' '10 ' '11 ' '12 ' '13 ' '14 ' '15 ' '16 ' '17 ' '18 '\n",
" '19 ' '20 ' '21 ' '22 ' '23 ' '24 ' '25 ' '26 ' '27 ' '28 ' '29 ' '30 '\n",
" '31 ' '32 ' '34 ' '35 ' '36 ' '37 ' '38 ' '39 ' '40 ' '41 ' '42 ' '43 '\n",
" '44 ' '45 ' '46 ' '47 ' '48 ' '49 ' '50 ' '51 ' '52 ' '53 ' '54 ' '55 '\n",
" '56 ' '57 ' '64 ' '65 ' '66 ' '67 ' '68 ' '69 ' '70 ' '71 ' '72 ' '74 '\n",
" '75 ' '76 ' '77 ' '78 ' '79 ' '80 ' '83 ' '84 ' '85 ' '86 ' '87 ' '88 '\n",
" '89 ' '90 ' '91 ' '92 ' '93 ' '94 ' '95 ' '96 ' '97 ' '98 ' '99 ' '100 '\n",
" '101 ' '102 ' '103 ' '104 ' '105 ' '106 ' '107 ' '108 ' '109 ' '114 '\n",
" '115 ' '116 ' '117 ' '118 ' '119 ' '120 ' '121 ' '122 ' '123 ' '124 '\n",
" '125 ' '126 ' '127 ' '>']\n",
"['<EVQLLESGGEVKKPGASVKVSCRASGYTFRNYGLTWVRQAPGQGLEWMGWISAYNGNTNYAQKFQGRVTLTTDTSTSTAYMELRSLRSDDTAVYFCARDVPGHGAAFMDVWGTGTTVTVSS>|<DIQLTQSPLSLPVTLGQPASISCRSSQSLEASDTNIYLSWFQQRPGQSPRRLIYKI-SNRDSGVPDRFSGSGSGTHFTLRISRVEADDVAVYYCMQGTHWPPAFGQGTKVDIK>', '<EVQLLESGGEVKKPGASVKVSCRASGYTFRNYGLTWVRQAPGQGLEWMGWISAYNGNTNYAQKFQGRVTLTTDTSTSTAYMELRSLRSDDTAVYFCARDVPGHGAAFMDVWGTGTT----->|<-----------PVTLGQPASISCRSSQSLEASDTNIYLSWFQQRPGQSPRRLIYKI-SNRDSGVPDRFSGSGSGTHFTLRISRVEADDVAVYYCMQGTHWPPAFGQGTKVDIK>', '<------SGGEVKKPGASVKVSCRASGYTFRNYGLTWVRQAPGQGLEWMGWISAYNGNTNYAQKFQGRVTLTTDTSTSTAYMELRSLRSDDTAVYFCAR**PGHGAAFMDVWGTGTTVTVSS>|<DIQLTQSPLSLPVTLGQPASISCRSS*SLEASDTNIYLSWFQQRPGQSPRRLIYKI*N-RDSGVPDRFSGSGSGTHFTLRISRVEADDVAVYYCMQGTHWPPAFGQGTKVDIK>']\n",
"[[[ 9.31621838 -3.42184329 -3.59397745 ... -14.73707485 -6.8935833\n",
" -0.23662776]\n",
" [ -3.54718232 -5.84866619 -4.02423859 ... -12.93966579 -9.5614481\n",
" -4.48473835]\n",
" [-11.94997597 -2.245543 -5.69481373 ... -15.19639015 -17.97454071\n",
" -12.56952095]\n",
" ...\n",
" [ -8.94504833 -0.42261261 -4.95588207 ... -16.66817474 -15.2224741\n",
" -10.37267494]\n",
" [-11.65150356 -5.44477606 -2.95585775 ... -16.25555801 -9.75158596\n",
" -11.75897026]\n",
" [ 1.79469728 -1.95846701 -3.59784532 ... -14.95585823 -7.47080708\n",
" -0.95226753]]\n",
"\n",
" [[ 8.55518723 -3.83663297 -2.33595967 ... -13.87456799 -8.14840603\n",
" -0.42472434]\n",
" [ -4.40701294 -5.53201008 -3.69397402 ... -12.97877789 -9.86258411\n",
" -4.95414352]\n",
" [-11.95642853 -3.86210871 -5.80935192 ... -14.89213085 -16.94556236\n",
" -11.36959839]\n",
" ...\n",
" [ -7.75924015 -0.66524202 -4.08643246 ... -16.16580772 -14.76507473\n",
" -8.3507061 ]\n",
" [-11.91039753 -4.86995983 -2.74777436 ... -16.07694817 -8.44974899\n",
" -10.45223904]\n",
" [ 0.86006832 -2.37964034 -3.58130741 ... -15.35423565 -7.73035526\n",
" -1.11989737]]\n",
"\n",
" [[ -4.37902737 -7.55587149 1.21958363 ... -15.48622513 -6.021842\n",
" -3.79647374]\n",
" [ 0. 0. 0. ... 0. 0.\n",
" 0. ]\n",
" [ 0. 0. 0. ... 0. 0.\n",
" 0. ]\n",
" ...\n",
" [ -8.94207573 -0.51090252 -5.09760332 ... -16.69521713 -15.45450687\n",
" -10.50823212]\n",
" [-11.92354965 -5.55152607 -2.87666893 ... -16.40607834 -10.19431686\n",
" -12.1328764 ]\n",
" [ 2.42200375 -2.01573253 -3.61701298 ... -14.9590435 -7.19029331\n",
" -0.89830256]]]\n"
]
}
],
"source": [
"results = ablang(only_both_chains_seqs, mode='likelihood', align=True)\n",
"\n",
"print(results.number_alignment)\n",
"print(results.aligned_seqs)\n",
"print(results.aligned_embeds)"
]
},
{
"cell_type": "code",
"execution_count": 9,
"id": "56be8cad",
"metadata": {},
"outputs": [
{
"data": {
"text/plain": [
"[array([[9.9955505e-01, 2.9358694e-06, 2.4716087e-06, ..., 3.5776201e-11,\n",
" 9.1196831e-08, 7.0967326e-05],\n",
" [4.1573694e-06, 4.1619489e-07, 2.5800944e-06, ..., 3.4650952e-10,\n",
" 1.0159109e-08, 1.6279575e-06],\n",
" [7.8059600e-08, 1.2794037e-03, 4.0645118e-05, ..., 3.0375720e-09,\n",
" 1.8879491e-10, 4.2010839e-08],\n",
" ...,\n",
" [3.4210879e-07, 1.7195340e-03, 1.8477240e-05, ..., 1.5137445e-10,\n",
" 6.4255873e-10, 8.2064140e-08],\n",
" [9.1038084e-09, 4.5161755e-06, 5.4411950e-05, ..., 9.1139631e-11,\n",
" 6.0862085e-08, 8.1761966e-09],\n",
" [8.5759175e-04, 2.0104915e-05, 3.9023766e-06, ..., 4.5562460e-11,\n",
" 8.1156479e-08, 5.4990651e-05]], shape=(238, 26), dtype=float32),\n",
" array([[9.9939799e-01, 4.1499175e-06, 1.8611167e-05, ..., 1.8139243e-10,\n",
" 5.5649299e-08, 1.2583815e-04],\n",
" [1.6735513e-06, 5.4332406e-07, 3.4143472e-06, ..., 3.1693398e-10,\n",
" 7.1501400e-09, 9.6832969e-07],\n",
" [3.7784993e-08, 1.2377645e-04, 1.7658784e-05, ..., 2.0061326e-09,\n",
" 2.5737484e-10, 6.7947965e-08],\n",
" ...,\n",
" [1.1050455e-06, 1.3312638e-03, 4.3497097e-05, ..., 2.4686178e-10,\n",
" 1.0018089e-09, 6.1165900e-07],\n",
" [5.7270397e-09, 6.5396339e-06, 5.4601755e-05, ..., 8.8801404e-11,\n",
" 1.8233513e-07, 2.4615032e-08],\n",
" [7.3952030e-04, 2.8970928e-05, 8.7113440e-06, ..., 6.7168833e-11,\n",
" 1.3746008e-07, 1.0210846e-04]], shape=(222, 26), dtype=float32),\n",
" array([[9.99685407e-01, 3.35662639e-06, 1.14241482e-06, ...,\n",
" 2.32460891e-11, 6.88188067e-08, 5.69467156e-05],\n",
" [6.38133372e-07, 1.01300586e-07, 5.64459742e-06, ...,\n",
" 4.09234556e-11, 2.53804799e-09, 4.31722100e-07],\n",
" [1.49096788e-08, 2.04515047e-04, 9.23794141e-06, ...,\n",
" 7.46306961e-10, 2.92107380e-11, 2.21786500e-08],\n",
" ...,\n",
" [2.15093763e-07, 1.06453872e-03, 1.62486140e-05, ...,\n",
" 1.12102910e-10, 1.47300866e-10, 4.73037538e-08],\n",
" [4.30136682e-09, 3.09317988e-06, 3.96632568e-05, ...,\n",
" 5.24226877e-11, 2.39579450e-08, 3.86403221e-09],\n",
" [9.77773685e-04, 1.29533228e-05, 2.78623725e-06, ...,\n",
" 2.73364300e-11, 3.96418649e-08, 4.04014427e-05]],\n",
" shape=(238, 26), dtype=float32)]"
]
},
"execution_count": 9,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
"ablang(only_both_chains_seqs, mode='probability')"
]
},
{
"cell_type": "markdown",
"id": "8f0a71ec-e916-4330-90d0-13a4b1121a89",
"metadata": {},
"source": [
"## **Pseudo log likelihood and Confidence scores**\n",
"\n",
"The pseudo log likelihood and confidence represents two methods for calculating the uncertainty for the input sequence.\n",
"\n",
"- pseudo_log_likelihood: For each position, the pseudo log likelihood is calculated when predicting the masked residue. The final score is an average across the whole input. This is similar to the approach taken in the ESM-2 paper for calculating pseudo perplexity [(Lin et al., 2023)](https://doi.org/10.1126/science.ade2574).\n",
"\n",
"- confidence: For each position, the log likelihood is calculated without masking the residue. The final score is an average across the whole input. \n",
"\n",
"**NB:** The **confidence is fast** to compute, requiring only a single forward pass per input. **Pseudo log likelihood is slow** to calculate, requiring L forward passes per input, where L is the length of the input.\n",
"\n",
"**NB:** It is recommended to use **pseudo log likelihood for final results** and **confidence for exploratory work**."
]
},
{
"cell_type": "code",
"execution_count": 10,
"id": "83f3064b-48a7-42fb-ba82-ec153ea946da",
"metadata": {},
"outputs": [
{
"data": {
"text/plain": [
"array([1.96673731, 2.04801253, 2.09881898, 1.82533665, 1.97255249])"
]
},
"execution_count": 10,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
"results = ablang(all_seqs, mode='pseudo_log_likelihood')\n",
"np.exp(-results) # convert to pseudo perplexity"
]
},
{
"cell_type": "code",
"execution_count": 11,
"id": "42cc8b34-5ae9-4857-93fe-a438a0f2a868",
"metadata": {},
"outputs": [
{
"data": {
"text/plain": [
"array([1.2636038, 1.126463 , 1.3123759, 1.2140924, 1.1805094],\n",
" dtype=float32)"
]
},
"execution_count": 11,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
"results = ablang(all_seqs, mode='confidence')\n",
"np.exp(-results)"
]
},
{
"cell_type": "markdown",
"id": "e0b63e48-b2a1-4a8e-8ecb-449748a2cb25",
"metadata": {},
"source": [
"## **restore**\n",
"\n",
"This mode can be used to restore masked residues, and fragmented regions with \"align=True\". "
]
},
{
"cell_type": "code",
"execution_count": 12,
"id": "2d5b725c-4eac-4a4b-9331-357c3ac140f7",
"metadata": {},
"outputs": [
{
"data": {
"text/plain": [
"array(['<EVQLLESGGEVKKPGASVKVSCRASGYTFRNYGLTWVRQAPGQGLEWMGWISAYNGNTNYAQKFQGRVTLTTDTSTSTAYMELRSLRSDDTAVYFCARDVPGHGAAFMDVWGTGTTVTVSS>|<DIQLTQSPLSLPVTLGQPASISCRSSQSLEASDTNIYLSWFQQRPGQSPRRLIYKISNRDSGVPDRFSGSGSGTHFTLRISRVEADDVAVYYCMQGTHWPPAFGQGTKVDIK>',\n",
" '<EVQLLESGGEVKKPGASVKVSCRASGYTFRNYGLTWVRQAPGQGLEWMGWISAYNGNTNYAQKFQGRVTLTTDTSTSTAYMELRSLRSDDTAVYFCARDVPGHGAAFMDVWGTGTT>|<PVTLGQPASISCRSSQSLEASDTNIYLSWFQQRPGQSPRRLIYKISNRDSGVPDRFSGSGSGTHFTLRISRVEADDVAVYYCMQGTHWPPAFGQGTKVDIK>',\n",
" '<EVQLVQSGGEVKKPGASVKVSCRASGYTFRNYGLTWVRQAPGQGLEWMGWISAYNGNTNYAQKFQGRVTLTTDTSTSTAYMELRSLRSDDTAVYFCARDPPGHGAAFMDVWGTGTTVTVSS>|<DIQLTQSPLSLPVTLGQPASISCRSSQSLEASDTNIYLSWFQQRPGQSPRRLIYKISNRDSGVPDRFSGSGSGTHFTLRISRVEADDVAVYYCMQGTHWPPAFGQGTKVDIK>'],\n",
" dtype='<U238')"
]
},
"execution_count": 12,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
"restored = ablang(only_both_chains_seqs, mode='restore')\n",
"restored"
]
},
{
"cell_type": "code",
"execution_count": 13,
"id": "0e9615f7-c490-4947-96f4-7617266c686e",
"metadata": {},
"outputs": [
{
"data": {
"text/plain": [
"array(['<EVQLLESGGEVKKPGASVKVSCRASGYTFRNYGLTWVRQAPGQGLEWMGWISAYNGNTNYAQKFQGRVTLTTDTSTSTAYMELRSLRSDDTAVYFCARDVPGHGAAFMDVWGTGTTVTVSS>|<DIQLTQSPLSLPVTLGQPASISCRSSQSLEASDTNIYLSWFQQRPGQSPRRLIYKISNRDSGVPDRFSGSGSGTHFTLRISRVEADDVAVYYCMQGTHWPPAFGQGTKVDIK>',\n",
" '<EVQLLESGGEVKKPGASVKVSCRASGYTFRNYGLTWVRQAPGQGLEWMGWISAYNGNTNYAQKFQGRVTLTTDTSTSTAYMELRSLRSDDTAVYFCARDVPGHGAAFMDVWGTGTTVTVSS>|<DVVMTQSPLSLPVTLGQPASISCRSSQSLEASDTNIYLSWFQQRPGQSPRRLIYKISNRDSGVPDRFSGSGSGTHFTLRISRVEADDVAVYYCMQGTHWPPAFGQGTKVDIK>',\n",
" '<QVQLVQSGGEVKKPGASVKVSCRASGYTFRNYGLTWVRQAPGQGLEWMGWISAYNGNTNYAQKFQGRVTLTTDTSTSTAYMELRSLRSDDTAVYFCARDPPGHGAAFMDVWGTGTTVTVSS>|<DIQLTQSPLSLPVTLGQPASISCRSSQSLEASDTNIYLSWFQQRPGQSPRRLIYKISNRDSGVPDRFSGSGSGTHFTLRISRVEADDVAVYYCMQGTHWPPAFGQGTKVDIK>'],\n",
" dtype='<U238')"
]
},
"execution_count": 13,
"metadata": {},
"output_type": "execute_result"
}
],
"source": [
"restored = ablang(only_both_chains_seqs, mode='restore', align = True)\n",
"restored"
]
},
{
"cell_type": "code",
"execution_count": null,
"id": "d80020ce",
"metadata": {},
"outputs": [],
"source": []
}
],
"metadata": {
"kernelspec": {
"display_name": "lib_transformer",
"language": "python",
"name": "python3"
},
"language_info": {
"codemirror_mode": {
"name": "ipython",
"version": 3
},
"file_extension": ".py",
"mimetype": "text/x-python",
"name": "python",
"nbconvert_exporter": "python",
"pygments_lexer": "ipython3",
"version": "3.10.18"
}
},
"nbformat": 4,
"nbformat_minor": 5
}
|